SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V4JZZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4JZZ7
Domain Number 1 Region: 269-411
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-33
Family cAMP-binding domain 0.000000408
Further Details:      
 
Domain Number 2 Region: 135-266
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-32
Family cAMP-binding domain 0.000000241
Further Details:      
 
Domain Number 3 Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000249
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V4JZZ7
Sequence length 418
Comment (tr|A0A1V4JZZ7|A0A1V4JZZ7_PATFA) cAMP-dependent protein kinase type II-beta regulatory subunit {ECO:0000313|EMBL:OPJ77756.1} KW=Complete proteome; Reference proteome OX=372326 OS=Patagioenas fasciata monilis. GN=AV530_000065 OC=Patagioenas.
Sequence
MSISIPAGLTELLQGFTVEVLRSQPGDLLEFALQYFGRLKEEAAKAAADKEASGRKAGTP
APGHDRGGQPPRRAPLDARGVNFAEEPMQTDSESGEEEEKFPAPVINRFTRRASVCAEAY
NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVEGGEH
VIDQGDDGDNFYVIDRGTYDIYVKCDGVGRCVGTYDNRGSFGELALMYNTPRAATIIATS
PGAIWGLDRVTFRRIIVKNNAKKRRMYENFIESLPFLKSLEVSERLKVVDVIGTKVYKDG
EQIIAQGDLADSFFIVESGEVRIIMTRKGKQDVEENGAVEIARCSRGQYFGELALVTNKP
RAASAFALGTVKCLVMDVQAFERLLGPCMEILKRNIANYEEQLVALFGSNMDIADPSA
Download sequence
Identical sequences A0A1V4JZZ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]