SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V4K399 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4K399
Domain Number 1 Region: 94-144
Classification Level Classification E-value
Superfamily Orange domain-like 3.27e-16
Family Hairy Orange domain 0.0025
Further Details:      
 
Domain Number 2 Region: 20-89
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000471
Family HLH, helix-loop-helix DNA-binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V4K399
Sequence length 269
Comment (tr|A0A1V4K399|A0A1V4K399_PATFA) Uncharacterized protein {ECO:0000313|EMBL:OPJ78942.1} KW=Complete proteome; Reference proteome OX=372326 OS=Patagioenas fasciata monilis. GN=AV530_004910 OC=Patagioenas.
Sequence
MEKSSASPVAATPASVNATPDKPKTAAEHRKSSKPIMEKRRRARINESLGQLKTLILDAL
KKDSSRHSKLEKADILEMTVKHLRSLQRAQMTAALSTDPTVLGKYRAGFSECMNEVTRFL
STCEGVNTEVRTRLLGHLASCMTQINAMNYPAPPPPPPLPPAAAFGPPLVPPGSGAGPLP
AQPLLLAVLCCPCTVAHPRLPPLPRRLAHHLAQLTPSGDPELVNVLREAPLPCSWLLGLV
ECSSPGTEGRTEPTLCSEKHLQDLCGNGI
Download sequence
Identical sequences A0A1V4K399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]