SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V4PA08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4PA08
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily YugE-like 1.28e-24
Family YugE-like 0.00000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V4PA08
Sequence length 87
Comment (tr|A0A1V4PA08|A0A1V4PA08_9BACI) Uncharacterized protein {ECO:0000313|EMBL:OPX03565.1} KW=Complete proteome OX=1954237 OS=Geobacillus sp. LEMMY01. GN=B1A75_07900 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MDGQQLNRLLLEWIGAWDPFGLGKDAYDVEAASVLQAVYETEDARTLAARIQSIYEFAFD
EPIPFPHCLKLARRLLELKQAASCPLP
Download sequence
Identical sequences A0A063YPD8 A0A0E0TFE3 A0A0K2H726 A0A142D3G9 A0A1Q5SLY1 A0A1V4PA08 A0A1V9CLK0 A0A2H5KJU4
gi|261420369|ref|YP_003254051.1| gi|319768037|ref|YP_004133538.1| 544556.GYMC61_3009 WP_013524508.1.20723 WP_013524508.1.3446 WP_013524508.1.38928 WP_013524508.1.50933 WP_013524508.1.59104 WP_013524508.1.77642 WP_013524508.1.80994 WP_013524508.1.92435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]