SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V4UP53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4UP53
Domain Number 1 Region: 6-255
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 6.67e-108
Family Methyl-coenzyme M reductase gamma chain 0.0000000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V4UP53
Sequence length 255
Comment (tr|A0A1V4UP53|A0A1V4UP53_9EURY) Methyl-coenzyme M reductase subunit gamma {ECO:0000313|EMBL:OPX74621.1} OX=1811684 OS=Methanosaeta sp. PtaB.Bin018. GN=A4E44_01894 OC=Methanosaetaceae; Methanothrix.
Sequence
MAYTPQFYPGSTSVGINRRKHMSGNIEKLRDIPEADVVAIMGHRAPGADYASTHPPLKEM
GEPDCPVRQLVAPTAGAAAGDRVRYSQWTDSMYFAPSIPYFRSYWGAINCKGCDPGTLSG
RQIIEARERDIEKYTKQQYDSEMTDVALCSMRGCTVHGHSLRLEENGMQFDMLARTEMGK
DGNVYAVKDQVGIPLDKKINLGKPMTEAEAKKRTTIFRFDGVPMGGKIGARKFDEAIEMT
HHMWEYRSKWGYRPE
Download sequence
Identical sequences A0A1V4UP53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]