SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V4XDQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4XDQ9
Domain Number 1 Region: 1-127,154-213
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.49e-35
Family Nucleotide and nucleoside kinases 0.0000216
Further Details:      
 
Domain Number 2 Region: 132-164
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.000000538
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V4XDQ9
Sequence length 214
Comment (tr|A0A1V4XDQ9|A0A1V4XDQ9_9DELT) Adenylate monophosphate kinase {ECO:0000256|HAMAP-Rule:MF_00235} OX=1811716 OS=Syntrophaceae bacterium PtaB.Bin038. GN=A4E67_01266 OC=Syntrophaceae.
Sequence
MKIILLGAPGAGKGTVAKLLTDYDGSVQISTGDILRAAVREGTDLGKEAKAYMDRGDLVP
DSLIMRIMEVRLQEPDCARGFILDGFPRTIAQAEALKTLLKKLNQELDMVVNLEVPREVI
LDRLTTRRTCSNPSCQEIYNVKSMPPNPDGTCKKCGSKVVQRDDETEAAILFRLETYNQK
TAPLIGFYEKEGLLKNFASLSSAETVEAVKKALK
Download sequence
Identical sequences A0A1V4XDQ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]