SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V4YV09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4YV09
Domain Number 1 Region: 6-251
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 7.46e-122
Family Methyl-coenzyme M reductase gamma chain 0.0000000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V4YV09
Sequence length 252
Comment (tr|A0A1V4YV09|A0A1V4YV09_9EURY) Methyl-coenzyme M reductase subunit gamma {ECO:0000256|PIRNR:PIRNR000264} OX=1811677 OS=Methanocella sp. PtaU1.Bin125. GN=A4E28_03047 OC=Methanocellaceae; Methanocella.
Sequence
MAYKPQFYPGKTSVAQNRKKFMDPSYKMEKLRSLSDDDVVLMLGHRAPGSAYKTIHPPLT
EANEPDDPIRKIVEPIPGAKTGDRIRYNQYADSMYFAPMVPYLRSWMAATRYRGVDPGTL
SGRQIIETRERDLERITKEIMETEQFDPARESIRGCTVHGHSLRLNENGMMFDMLQRSVL
DKSGKVFQVKDQVGDPLDRKVDLGKPMSEAELKKRTTIYRVDGVAFRSDEEVVGWVQRIF
TLRTKFGFSPKV
Download sequence
Identical sequences A0A1V4YV09

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]