SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V5BPS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V5BPS9
Domain Number 1 Region: 23-59
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000000000658
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0014
Further Details:      
 
Domain Number 2 Region: 2-28,56-108
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000759
Family Nucleotide and nucleoside kinases 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V5BPS9
Sequence length 111
Comment (tr|A0A1V5BPS9|A0A1V5BPS9_9DELT) Adenylate kinase {ECO:0000256|RuleBase:RU003331} OX=1811702 OS=Syntrophorhabdus sp. PtaU1.Bin002. GN=A4E62_03179 OC=Syntrophorhabdaceae; Syntrophorhabdus.
Sequence
MKIDAVISLEVDAEELVLRLTSRRMCPKCGAIYNQISQPPRAEGICDACGSALEQRADDR
RSTVENRLAVYREQTSPVMDYYRSQGLLKPVDGSKSPEEVYRSFKSALPKA
Download sequence
Identical sequences A0A1V5BPS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]