SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V5MNA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V5MNA0
Domain Number 1 Region: 4-93
Classification Level Classification E-value
Superfamily MTH889-like 9.68e-34
Family MTH889-like 0.00000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V5MNA0
Sequence length 96
Comment (tr|A0A1V5MNA0|A0A1V5MNA0_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:OPZ94565.1} OX=1852892 OS=Firmicutes bacterium ADurb.Bin419. GN=BWY74_00470 OC=Bacteria; Firmicutes.
Sequence
MAEGLIRIVLDILKPHEPTIPYFAKFLSGVSGVEGVNITLMEIDKETENIKVTMQGNDLN
FEEISQAIEQYGGSIHSVDEVVAGKTMVEEVTTPQD
Download sequence
Identical sequences A0A1V5MNA0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]