SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V6GXV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V6GXV7
Domain Number 1 Region: 39-155
Classification Level Classification E-value
Superfamily TM1646-like 3.27e-27
Family TM1646-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V6GXV7
Sequence length 156
Comment (tr|A0A1V6GXV7|A0A1V6GXV7_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OQC30717.1} OX=1852923 OS=Thermotogae bacterium ADurb.Bin062. GN=BWX67_01617 OC=Bacteria; Thermotogae.
Sequence
MRIEPPDNQINDKKKAGKVKRKGKRTDSSEPYEQEWTGFIDVLGNIQLDQAEEEAKRSLQ
EVLKAGNRFSRSPTNRNFQSYRDSIKRFLRYIEKGLYRIREDVGVSADFPKLYMVADIVD
EKMHQIASLLMKNEKNTLQFAGKVEEINGLILDLYR
Download sequence
Identical sequences A0A1V6GXV7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]