SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V6ITK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V6ITK6
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily MTH1598-like 3.66e-18
Family MTH1598-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V6ITK6
Sequence length 78
Comment (tr|A0A1V6ITK6|A0A1V6ITK6_9DELT) Uncharacterized protein {ECO:0000313|EMBL:OQC53809.1} OX=1852863 OS=Deltaproteobacteria bacterium ADurb.Bin022. GN=BWX55_00842 OC=Bacteria; Proteobacteria; Deltaproteobacteria.
Sequence
MLINFLRELLYLFNGEQFITGNCEIIEFSNKKIQARLTGGSFNNKKHLIKTEIKAVTYSG
AKVEKIESGWKARVIFDV
Download sequence
Identical sequences A0A1V6ITK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]