SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V6R9M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V6R9M9
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.9e-29
Family Nip7p homolog, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 97-172
Classification Level Classification E-value
Superfamily PUA domain-like 3.2e-21
Family PUA domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V6R9M9
Sequence length 184
Comment (tr|A0A1V6R9M9|A0A1V6R9M9_9EURO) 60S ribosome subunit biogenesis protein NIP7 {ECO:0000256|PIRNR:PIRNR017190} KW=Complete proteome; Reference proteome OX=60172 OS=Penicillium solitum. GN=PENSOL_c010G07509 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MRSLTEEETRTLFTKLASYTGRSLNSLITPAEDGTMSVFRLQGSRVYYVNKEIANLSVSF
PRENLLSCGTMIGKYTKTGKFRINLTALDLLAQHARYKVWIKANGVMPLLYGGSVLKAHV
ARFSEDVPENAGVIILDSNDVPLGFGVTARSSAQIAKLDPTSIAVHRQADAGEYLREEDT
LFTT
Download sequence
Identical sequences A0A1V6R9M9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]