SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V6RG22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V6RG22
Domain Number 1 Region: 12-124
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000358
Family Txnl5-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V6RG22
Sequence length 125
Comment (tr|A0A1V6RG22|A0A1V6RG22_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OQE00586.1} KW=Complete proteome; Reference proteome OX=29845 OS=Penicillium vulpinum. GN=PENVUL_c049G07349 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MPIIKNFTLPSSAKKLALSPNSKLFIAFISSPDPITKQPWCPDVRDALPHINNAFAGDDA
PALAIVEVGQKPEWKDPHNFYRTTWDTKNIPALVRYQQVNGEVTETGRLVEGEILNKERL
LAFII
Download sequence
Identical sequences A0A1V6RG22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]