SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V8TYC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V8TYC1
Domain Number 1 Region: 32-182
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 4.97e-25
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00033
Further Details:      
 
Domain Number 2 Region: 388-435,519-553
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000105
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V8TYC1
Sequence length 594
Comment (tr|A0A1V8TYC1|A0A1V8TYC1_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:OQO16435.1} KW=Complete proteome; Reference proteome OX=1974281 OS=Rachicladosporium sp. CCFEE 5018. GN=B0A51_16619 OC=Rachicladosporium.
Sequence
MATSPAQSRPSRPPRPRRGTATPELDTGMRNNELKIIFASVGCTDSRLIDELLPSLADIP
DVTLRAVLDKGYRGQDMIKASTYCQTMPNVARQLAVRDVVEIEQEAAELCEWADVLVIAP
MDANNLAKMLHGDTDNLLLEVLRSWNVSKKILMAPGMSSLMWENPMTKKQLTKIRRKWNF
VQVLHPLLWAFEGDRKKITSWEALEEVTEAVRNQVDLMNIGKDVQVSPSQRQVFSQCTST
SSNRLPPELWSLIIDHTGDWELAQTLHIYTNLPPPAEWTWHTKPQGPRNYMEALELTILR
GNLADVKHFIATHSVPRWLSKLCIKLIMRFAMTDLLAYLETTHHTLFWTTFGHTFLPDKA
SSVFGRTEILEFWRTSPSFLTKEYTPEALDGASRAGFVNVLEWWHHSNLPLKYTEAAMEQ
ASAQNHIPVLEWWRTQSSPPGEPSSPDSTSASPPLRLKPGKSLVFATQNGHLPVLDWYLT
STLPTLSFPHEDTVPKLASTHNHPSLLALWHSHKGNKMQFDNQVLIGATKGGHVEVLEWW
KKSGLRVEYKTCDVEEALEDGLEGEGGVGVRRWWATNGLNLGVGTSEWMRVKVL
Download sequence
Identical sequences A0A1V8TYC1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]