SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9Y004 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9Y004
Domain Number 1 Region: 91-186
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-31
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 8-62
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000000294
Family L27 domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V9Y004
Sequence length 195
Comment (tr|A0A1V9Y004|A0A1V9Y004_9ACAR) Protein lin-7 homolog {ECO:0000256|PIRNR:PIRNR038039} KW=Complete proteome; Reference proteome OX=418985 OS=Tropilaelaps mercedesae. GN=BIW11_05971 OC=Laelapidae; Tropilaelaps.
Sequence
MAALGESLNLERDINRAVELLQKLQRSSVGGEKLAALEQVLSSEFLAAVRQVYEQVHRTA
DMGAGPAASADIRASATAKATVAAFAASEGRAQPRVVRLPKTDEGLGFNVMGGKEQNSAI
YISRIIPGGLAERQGGLRRGDQLLAVNGVSVEGENHERAVELLKQAQGTVTLVVRYAPHV
LEQMEMRFDRQHHNK
Download sequence
Identical sequences A0A1V9Y004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]