SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9Y9R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9Y9R0
Domain Number 1 Region: 113-214
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000126
Family Pseudo ankyrin repeat 0.012
Further Details:      
 
Domain Number 2 Region: 201-224,291-317,378-428
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000235
Family Pseudo ankyrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V9Y9R0
Sequence length 519
Comment (tr|A0A1V9Y9R0|A0A1V9Y9R0_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OQR82453.1} OX=1202772 OS=Achlya hypogyna. GN=ACHHYP_15983 OC=Achlya.
Sequence
MAARVFRCRDLIREVAQYQAGLHISLIHLPPRCFGDHDAPDETEWGHHYAIAVATDTVVS
AWFADYGKHGLSQLLEAHPGVAHGVFYWAVASCGLDVLWSLEATYGHLAPRGLLDVAAAR
GNLSLVTWLHTHKSTGCSSNAMDMAADGGHLRVVEFLHRHRTEGATVAGFEAAVQQGHIA
IVRFLYDAYPRLCRPNVYEVAAAYGQLDVLRYLCRYTAPFAVSIQRAKQTAAQTGQFAIL
AELQMLYPVREHLVPIARGALRRQHTALVHFFTTELWPTSGSLEAFIGRPAVQAAIIEAA
RCNNLALLTLLDAHEPRVPWPTDALTAAAAVHTDVVRFIAARHPEATSAAALDAAVASSR
APLELIIVLLHTLHLPADPRLAVLHGRLDVLEYYAAHPAIVPENSWNAELANLAAAHGRL
EIIAFLHAHLPEGWSVAAMNAAASFGHVEVVSFLHEHRTEGCSDEGLERALARRHKATVA
FLCRACPHAFSPKVLASATDFLRIPSRYDRKCSLADVVC
Download sequence
Identical sequences A0A1V9Y9R0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]