SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9YKI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9YKI2
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000327
Family Pseudo ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V9YKI2
Sequence length 147
Comment (tr|A0A1V9YKI2|A0A1V9YKI2_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OQR86222.1} OX=74557 OS=Thraustotheca clavata. GN=THRCLA_10563 OC=Thraustotheca.
Sequence
MDKAAEFGYFDIVKYLHENRTEGCTTYAMDSAAKNGHLEIVKYLHENRTEGCTANVLWTF
PSFEITKVLLKNRTECCTKKAMLDVARKDKLDIIKYFHEIRAEGCSSKVYDVATTCTESV
VNYLKENCHACGSMCGDYFLQIMECDY
Download sequence
Identical sequences A0A1V9YKI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]