SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9YWR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9YWR4
Domain Number 1 Region: 83-261
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.57e-56
Family Brix domain 0.0018
Further Details:      
 
Domain Number 2 Region: 550-615,654-701
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000633
Family Calmodulin-like 0.016
Further Details:      
 
Domain Number 3 Region: 357-432,462-513
Classification Level Classification E-value
Superfamily EF-hand 0.000000000677
Family Calmodulin-like 0.028
Further Details:      
 
Domain Number 4 Region: 297-343
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000011
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V9YWR4
Sequence length 733
Comment (tr|A0A1V9YWR4|A0A1V9YWR4_9STRA) U3 small nucleolar ribonucleoprotein IMP4 {ECO:0000313|EMBL:OQR89990.1} OX=74557 OS=Thraustotheca clavata. GN=THRCLA_09480 OC=Thraustotheca.
Sequence
MSVRRNVRLRREYLYRKGLEGQERAQYERKVQLKQAIEGGKAIPTELRGVEDKLRKEMEY
DDEHHIVPKSHIDDEYQNAGMFDPKIAVTTSRDPSARLKKFAQEVRLIFPNAIRLNRGAH
TIGDLVESARANEFTDLVMITETRGEPDGLVVCHLPYGPTAYFSLQNVVMRHDIDDRATI
SEAYPHIILHQFESALGQRVGNILKYLFPVPKPDSKRVITFSNTDDFLSFRHHVFKQTGR
EVELQECGPRFELQLYQIKLGTMEQKEAENEWVLRPYMNTAKKRRSQLKIMASSYAKTIK
VPEGFPDTLRDFAREVLRQQDKVKTREDILQFGMKYFKDLAEKRAGINNGPLFASEKYMT
MADEEIEEYLWQLFRNVDPSNSDHLDLVDFRREFIKMIDYLKLNPLEKLRCAAEVDELEG
ATVSYPEFIASNIESPSYDANVGKEIVVEDGDFFLHGMLREEFASLLREILHHIDSDGVG
FVSRGNFLGCLQDGDIGLTRREINLIMFKIESDEVVYSDVISTLFESLVHAHANDLIDTP
RTEEMVETMLNKAFQSGDEESTGFLSFGALKTLLRMAGLGLTRIQTTALLSEAIEEEEDS
VNYESFAKRIASMVLRMIDYDTQVQMAASVRSYRGSEDYFAVYGMNQHEFENALTIAFEA
IDENSRGCLTRNELIEAIHNGLPHISPKHLACVLALAEVNQSSGEFEYGAIIHNGFQALQ
WLQEYSTLSAQLV
Download sequence
Identical sequences A0A1V9YWR4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]