SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9Z952 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9Z952
Domain Number 1 Region: 67-142,184-244
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000317
Family Calmodulin-like 0.045
Further Details:      
 
Domain Number 2 Region: 273-340,379-426
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000083
Family Calmodulin-like 0.028
Further Details:      
 
Domain Number 3 Region: 7-53
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000863
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V9Z952
Sequence length 458
Comment (tr|A0A1V9Z952|A0A1V9Z952_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OQR94538.1} OX=1202772 OS=Achlya hypogyna. GN=ACHHYP_01133 OC=Achlya.
Sequence
MASRYAKTIKVPDGFPDTLRNFAREVLRQQEKLKSREDILQFGMKYFKDLAEKRAGIHNG
PTFATEKYMTMADEEIDEFLWQVFRAADPANSGHVDITDFRKVFADIVDYLKLNPLERLR
CATEIDELENATVPYTDFVTAASRIISTLKKRKNIESPSYDASSTREIVPGDIDCLFHGL
LRDEFESLMREILRHIDLDNIGSVSRAEFLSCLQDGDVGLTRKEVNLVMYSVPDNGDNAI
VYAEVLPELFDILLHAHANDLLETPRSEEAVETQLNKAFASGDEDGTGYLSFSALKTTLR
LAGLGLTRIQTVALLSQAVEEEEDSVNYESFAKRIAPMVLRMVDYDTQTQIAAAVRSYRS
SEDYFTVQGMNQHEFANALTIAFEAIDEGERGCLSRHDITEAIQNAFPGISRQHLSSLVA
LTDTNHASMDLEYGPVVHNGFQALQWLQEYAVLSAQVV
Download sequence
Identical sequences A0A1V9Z952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]