SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9ZBD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9ZBD2
Domain Number 1 Region: 74-257
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.04e-62
Family Nucleotide and nucleoside kinases 0.00000778
Further Details:      
 
Domain Number 2 Region: 33-67
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000017
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V9ZBD2
Sequence length 264
Comment (tr|A0A1V9ZBD2|A0A1V9ZBD2_9STRA) Guanylate kinase {ECO:0000313|EMBL:OQR95316.1} OX=1202772 OS=Achlya hypogyna. GN=ACHHYP_20005 OC=Achlya.
Sequence
MDPQATLTFEELSILNERKEEIKRDHLAYLDQHPELKTLMSSFMSAVLMEKPTDVVAFAK
AHFDALTPIKIAPAPLVIAGPSGVGKGTLINRLMTKYPELFGFSVSHTTRGPREGEVNGV
AYHFVAIDEFDGEVAKGSFLEHANVHGNRYGTSKFAVEHVQAQEKICILDIDVQGVRQVK
NAKMKVNYLFVAPPSMADLEKRLRGRGTETEDKIKIRIANAKGEVDFGTAEGNFDKVLVN
NDLDEAFAELEETLAKLYPEVRFQ
Download sequence
Identical sequences A0A1V9ZBD2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]