SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9ZHP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9ZHP5
Domain Number 1 Region: 375-589
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.98e-22
Family Ankyrin repeat 0.0041
Further Details:      
 
Domain Number 2 Region: 152-252
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000275
Family Pseudo ankyrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V9ZHP5
Sequence length 642
Comment (tr|A0A1V9ZHP5|A0A1V9ZHP5_9STRA) Ankyrin repeat protein L63-like {ECO:0000313|EMBL:OQR97421.1} OX=74557 OS=Thraustotheca clavata. GN=THRCLA_06967 OC=Thraustotheca.
Sequence
MSLNLTVLDHLLSPRIEHIPHVLGTEKLIAIIVSYQNGWHYDTLMLTRLFREITSSDATL
HARSLASFIEQFPAWIQRYGSGRVEHHFSSYRRKRLVHYGLILGNVHVLECFEQCQLLQI
TQQDLQLAGQHGHINVIAFLEPRIHAKHAAVVMDQAVVNGHLDIVKYLHQKRIPVSEAAY
AEACSNGYDHVIRFLYEVGYRYFPWGVVANAAKQGHLGMIQFFHDIHYPELDGAVSIAAD
NGHMDIVEYLFEQRPYLWYSMPSNIAHYGFQKDYATSKVTIPLTPVKTDSLNLLVTNVLG
SRKVFRLIVSYQHGADKETLMLRQELRGIDSTMDDGVDLLPAALKRFHKLFPDWLKSRGI
DNLELHFPAALHRHLVYYAMVYNNVNILEYFHKIKTLELTYHDLYLAGSHGHMNVIKYLN
SVYNGTSMLEITMQSAVAKGHYNVMQFLQEQGVEVPAECFQIACEKGHLDIVQYLYQLGA
YDRRCKQIVAQTTINGHLDVLQFLHAKRFDGFDKYALLYAVEHGHLNIVRFLHSIRTEEM
YGLVYDAIPGGHLDVVKFLHQNGYKHDIKSVLWYALTKGQRDIARYLQEEATLKKRWSRF
SKQVAMKFQNLRNALRPQAPLNYSNALLTLEDVKPKDKSKKY
Download sequence
Identical sequences A0A1V9ZHP5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]