SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9ZML8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9ZML8
Domain Number 1 Region: 356-707
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.95e-28
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 97-370
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.17e-18
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 892-974
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000706
Family Pseudo ankyrin repeat 0.018
Further Details:      
 
Domain Number 4 Region: 783-964,1030-1056
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000249
Family Ankyrin repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V9ZML8
Sequence length 1059
Comment (tr|A0A1V9ZML8|A0A1V9ZML8_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OQR99245.1} OX=74557 OS=Thraustotheca clavata. GN=THRCLA_06572 OC=Thraustotheca.
Sequence
MMALPTPDDTMGPFVLSRKHSSSSAYSESGLQRRDSTTSSSDRPSDASRKSISEAPKLSA
FSRLTSWRRSNGNKVAENGDLDYLVNYGDTLTFTTDAIDLAAANGHLDVLQYLHVHRSEG
CTFAAMDKAAANGHLEIVTWLHLNRLEGCTTEAMDLAATNDHFDIVKFLHKHRSEGCTTN
AMDGAAANGHLAIVVWLFFNRHEGCTDVAMNLAASNGHVDVLTFLHENDIANVRNNMNEL
LDISVNHGQVNVVRWLIDTLATDVSYYRILDVAASENQLEIVQYLCQAKNGLVSLEVGRT
KSIISPAMLAYLESIPVQQAYWNAAFPMDIVALHGYLDFLEYLHHRNFAGICSEEAMALA
AGAGHLNVVIFLNENRTEGCSTHAIDFAAAHGHLEIIKYLLAERTEGGTQKALDEACLNG
HLDVVSYLFDSDITWIEKVNNVYALNAAASTGQLEVVKYLCTRSYGEPFLAIDFAVEYGQ
IAVARYLHQEYGAYSKIPPTDADMMAYLQTTKHASLWSMNPLDFSAGENRHDLIEWFSST
RETLYTTKAMDLAASNGHFDMVQWLYENRTEGCTSDALDYAAGNGHIDILQFLHDAYQQL
SWTSLALDLAAGNGHLTILKWLKENRDVEPTQQGFEWACRNGHLKVLEYLREMYPSLQGN
TKALELAAKMGHVNVIEWLVINDNVPLTLNAMEQAMINGHTRVAKYILTQAPTLSWSAKT
VDVALKKHQTDAAEWWVLDAQLPYTRQTKDLAAKRGSLRLLQYFIEKLSESDEVLIPHLC
DSFEAATVHGHNELVKYIHTKFELYVVRKQYKKALKQHYTLVTEYLEATHIEFWKSAPID
FAVRRHEIWVRWLHNKGYTATTAAMDEAAARGDLALVQWFHTNRTEGCTTAAMDAAAALG
RLDMVQWFHTHRFEGCTTDAMDLASQNGHFEVMQWLYDNRDEGCTAYAVNICAMTGRLDI
LKWLVDRIEVYTKNTQPAESFGYDTEDDFDPDLDPSEMEELKKKLRPGSGLTKGKSLSDA
LPLPSLAMPHHKLKSDSTDMLDMASEKGHLEMVEWLTKN
Download sequence
Identical sequences A0A1V9ZML8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]