SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9ZUX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9ZUX5
Domain Number 1 Region: 3-82
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000126
Family Pseudo ankyrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V9ZUX5
Sequence length 123
Comment (tr|A0A1V9ZUX5|A0A1V9ZUX5_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OQS01805.1} OX=74557 OS=Thraustotheca clavata. GN=THRCLA_21612 OC=Thraustotheca.
Sequence
MNIAANFDRIDMIKYLHASGNKACSSNAMDGAAAEGHLEIVKWCHENRNECCTTNAMDHA
ARNGHLDIVKFLHKNRTQGCTTAAASTLEIVKWLDENRTEGCTKLAMDNAARNRKLEYCQ
VLT
Download sequence
Identical sequences A0A1V9ZUX5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]