SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9ZV61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9ZV61
Domain Number 1 Region: 276-367
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000103
Family BRCT domain 0.0075
Further Details:      
 
Domain Number 2 Region: 378-459
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000249
Family DNA ligase 0.089
Further Details:      
 
Domain Number 3 Region: 523-595
Classification Level Classification E-value
Superfamily EF-hand 0.000000000171
Family Calmodulin-like 0.044
Further Details:      
 
Domain Number 4 Region: 478-516
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000785
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0053
Further Details:      
 
Domain Number 5 Region: 46-70
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000628
Family Ran binding protein zinc finger-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V9ZV61
Sequence length 599
Comment (tr|A0A1V9ZV61|A0A1V9ZV61_9STRA) Radial spoke protein 11 {ECO:0000313|EMBL:OQS01912.1} OX=74557 OS=Thraustotheca clavata. GN=THRCLA_05659 OC=Thraustotheca.
Sequence
MRQPLSTQKKKLQLQQYKDSDDESAMDTVVEDLEPLAKRARVQPKVNTWACTKCTFENPN
TSQHCGICASVKSSTDSNTTAAKEQTTAKATVPSTPVPLKELKESIAKVTLKTKATPAIS
KPVRPVSSRTSILQAKLPKPKISNAKPPISKSPTAKSPTKKTLAERQKSSRTKPKDAISK
TTENSILDTKVSTNDTIDSNNSAKAKVKPTRSTTSTQSTATKNGKEISELTAKTTLTKTT
STKATTTKTTKPVPTKSTSAKDQSSQGKSETRPKRFFIAISGADVATRQTLQSSIQAIDN
QCPNQLSSRIVDANVVMTHVIVTDASKRTMKMLFGIARGCWIVTDSWVFSSLEAGKWLPE
KDFQVEAYSHHQCNQVQLLKDLVFTISLTSKLEPPKDVVQSLITAAGGKVSTNSSRANYC
VCNEPNRRAQLASVPCVTPKWLFDSIAANKLQNPTHYLPGLGTVCLLVMDVNRIFSAEQI
VVPLDLPLILKEWTKDVIRAAPADVVAYSLQWFQEKAAEALNGKLSVAEIENIRKLFEPY
DVDMNGKMEARDLKSFVVHDLGLEVSDTELEAVVMLLDANNTGYLEFNDVLKWYSRQVA
Download sequence
Identical sequences A0A1V9ZV61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]