SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9ZVW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9ZVW5
Domain Number 1 Region: 104-250
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000000562
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V9ZVW5
Sequence length 257
Comment (tr|A0A1V9ZVW5|A0A1V9ZVW5_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OQS02158.1} OX=74557 OS=Thraustotheca clavata. GN=THRCLA_05444 OC=Thraustotheca.
Sequence
MSKWESIADVYAIIFDMAGPLTKYLSGLSPTLTEYQIQLIWCDVFQLNWDGDFKTLPQTT
LVSQTFRCIQTRWMYEKAQVHFKHRYQHLVMSMVIATQQQRYFPITITPLEAAPMENVWL
DELQSHLKNPITLANAAMVGGHLRLVKYLVEQYQLDICQNIYKIIPICGCSYRGLAMDIA
AERGDLEMIKYLFQGGNRSFSKIAMDIAATNGHFDVVKWLHLNLNIGCTWRAKKYAMNNG
HNHIIDYLDQHGLAQAI
Download sequence
Identical sequences A0A1V9ZVW5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]