SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W0A295 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W0A295
Domain Number 1 Region: 95-170
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000929
Family Pseudo ankyrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W0A295
Sequence length 198
Comment (tr|A0A1W0A295|A0A1W0A295_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OQS04301.1} OX=74557 OS=Thraustotheca clavata. GN=THRCLA_03453 OC=Thraustotheca.
Sequence
MSTEATATSTHSVENINQVIPSVALELALKECHDMIVSKSNSDTGILTRPKYFRGYTLTR
LICRGKVDLALEMLALYPQGEIEIPNTTTDLYYFTIDNAARAHSLELLKLLHQRSLGLCS
VNAMDTAATIGYLEMVRFLHENRTEGCSRRAFKMAKKFRHHKVLAYLEVNQTEGKKVKAP
VRQSDVYSGVLLLSCSVQ
Download sequence
Identical sequences A0A1W0A295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]