SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W0A5F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W0A5F3
Domain Number 1 Region: 75-173
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000157
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W0A5F3
Sequence length 181
Comment (tr|A0A1W0A5F3|A0A1W0A5F3_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OQS05421.1} OX=74557 OS=Thraustotheca clavata. GN=THRCLA_20622 OC=Thraustotheca.
Sequence
MYQQCKKYFQNGSLFFNKFYVDDNSLPCSLNGVQVVDILAAAMENLWLDELHDMLQYPIA
LVQAAIFYCNLRFLQYLVANHDIDLTRLENILIFPSIFFTLDFVARLGHFDMLKYLYKAG
IKKCTVKAMNNAARKSHFKIVKWLYENTTNGCSADILGSVLIKGHMKIVEYLQSELVDIY
R
Download sequence
Identical sequences A0A1W0A5F3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]