SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W0AB87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W0AB87
Domain Number 1 Region: 134-237
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 4.45e-16
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W0AB87
Sequence length 325
Comment (tr|A0A1W0AB87|A0A1W0AB87_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OQS07525.1} OX=74557 OS=Thraustotheca clavata. GN=THRCLA_00462 OC=Thraustotheca.
Sequence
MESVWHSTDLIREIVSYQHGICFDMYSILKVLQNMAWDNSDIFNTLPAALAPFHQLFKTW
FQTHGVRGLRQFPLRYSIELWYYSLLFGNVPMINYYHDHMPVDYVEWNLAVISGKVDAVS
FLLKEYPHGCFYLTMERAIEHGNLNILKILHQHGIPFPANSWKIVCEYGRLNIATYLHQE
HWAWKESWRGQATEVAAEKGHLNMIQFLHENNYDDAYTYHAMDAAAANGHLDIVRYLYVH
RTEGCSSLAISEATRYGHLDVVKFLHQYYESDQTTKKMEIGPLDITRYLNDDVTCTKGWS
RFRHKINQLLGNKSKQHFRELPRLI
Download sequence
Identical sequences A0A1W0AB87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]