SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W0WBW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W0WBW6
Domain Number 1 Region: 50-85
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W0WBW6
Sequence length 149
Comment (tr|A0A1W0WBW6|A0A1W0WBW6_HYPDU) Uncharacterized protein {ECO:0000313|EMBL:OQV12668.1} KW=Complete proteome; Reference proteome OX=232323 OS=Hypsibius dujardini (Water bear) (Macrobiotus dujardini). GN=BV898_13077 OC=Hypsibiidae; Hypsibius.
Sequence
MPHRHRSEDNIDDGEESHGSFQSVKALGGKPSRTIVTIAPKIYASAYSDDVWVMLKDYTK
EVLRNSPGDVLSWSSDYFARKVDERRKSAADYAIVSERNKKEHNHGQAPRGLGPHQVSRE
SQHEELDIELSVSDEERDHHHGDPHSEHH
Download sequence
Identical sequences A0A1W0WBW6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]