SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W2P6M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W2P6M8
Domain Number 1 Region: 42-90
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000000235
Family TNF receptor-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W2P6M8
Sequence length 91
Comment (tr|A0A1W2P6M8|A0A1W2P6M8_MOUSE) Tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) {ECO:0000313|Ensembl:ENSMUSP00000151279} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Tnfrsf14 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEPLPGWGSAPWSQAPTDNTFRLVPCVFLLNLLQRISAQPSCRQEEFLVGDECCPMCNPG
YHVKQVCSEHTGTVCAPCPPQTYTAHANGLS
Download sequence
Identical sequences A0A1W2P6M8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]