SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W2WGU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W2WGU1
Domain Number 1 Region: 5-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000123
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W2WGU1
Sequence length 439
Comment (tr|A0A1W2WGU1|A0A1W2WGU1_CIOIN) uncharacterized protein C8orf34 homolog {ECO:0000313|RefSeq:XP_002130689.1} OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN=LOC100180645 OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MSSKQRIQTYLKQNKISELFEEMMGKLIHDLPSKPVDYLIQLLQNRNAKKKVEVQQTYSK
TFPKPTSSNAANLWNDDKRRSPAKSPTKQSVTELDGKEQTGRQYSKPWLSNTKKDPKQSL
SQTLPSPTKSAGDNKLHSTSMDLNEMRKSKSKSKLEAEDEDVDLRLTYAKPKIYGKVRDE
SDSQFEEIQCQDKENKKVSSKPKQEIVSKQKRRQELSKILAAQNKEKKILNDDKEDTDDD
DAVELCEDYGDLHDEGVKNPPKSGVHISKTSKRQKEEIELVLNMSRFFDSLGGAVSVTHM
DGITPVPNVQEDDDFESASQVTGPRRPVWETPQSDIDTIVSKQNRRTNAAMFDLSSKVSK
SKSRVSQSGSAKVGSIKEGSTIVRKSKSGSLVEDKLSNHPKPTKSSKEPSVVSAGRRSLV
GERSRKSSQASVDRPKTAQ
Download sequence
Identical sequences A0A1W2WGU1
XP_002130689.1.78797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]