SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W2WI37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W2WI37
Domain Number 1 Region: 310-345
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000085
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W2WI37
Sequence length 368
Comment (tr|A0A1W2WI37|A0A1W2WI37_CIOIN) ciliogenesis-associated TTC17-interacting protein-like isoform X2 {ECO:0000313|RefSeq:XP_002131511.1} OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN=LOC100177369 OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MVDSNDSAVTAIEIDRNAQADETGIQFLKNIDPEELRLCFFRDQLVTVSEDGSAVGEFTA
SVERVTEAGKKLVLIHASSHGKVDGTPMGTTITTYLQPESLEVLRQEHIEFVKLPGHELE
KKTEMKRDMENGDLVIKRKVTKGNEIRKSKHRFTAKQTAGFVTEGSNLLLQRLMMRQGLN
TEISFITLDSEVGYLVKASYRPLPERSQTVFTKEIQVSGIERRVASVHDVPYTWQSFFMP
DGHLTLRIQVGSPAIVTLEKVPRLIQRDIVEPKPVFEKKKLIWEEDMEMNSRFLQRKEEL
KAGHEKYLREHPDATALIADFFQFLLLRRPHDVVGFAADFFSSFSSSFPEAPAYQHSGTT
AANAESFN
Download sequence
Identical sequences A0A1W2WI37
XP_002131511.1.78797 XP_018667963.1.78797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]