SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W4UMM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4UMM8
Domain Number 1 Region: 13-56
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000102
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0034
Further Details:      
 
Domain Number 2 Region: 179-250
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000611
Family Motor proteins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W4UMM8
Sequence length 427
Comment (tr|A0A1W4UMM8|A0A1W4UMM8_DROFC) fibrous sheath CABYR-binding protein {ECO:0000313|RefSeq:XP_017040967.1} KW=Complete proteome; Reference proteome OX=30025 OS=Drosophila ficusphila (Fruit fly). GN=LOC108087900 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MNYLIQRGKVRQQAINVPEGLPELLSDITREVLRCQPTKECLCQFIIDYLHSVIVTREKA
LVAKTILERALRQVDSIISDLCVCDLSKEKSELMGQVLEDCFRNFLEKRRCEMRRGKQAI
NFEDVDILEELLLKCKFSDEELSMSRPAIESAYKRFVEAYMSAERGADGTELLYQYFRDR
ELKRINEAMREKAAITIQSAWRGYWVRLQFPQEVCICTCADKKEDDEEEERRQRAASIIQ
RFFRKVMLRAATKPIADPCAEPTDATEPSEATTSPDATKSGLTDVDITTASSAPGAASVP
ATAPATAPATAPATAPGTAPGTAPGTAPGTAPVTAKTSETGLAEPEVPPAEGPPAEEPKA
AEAPVEEAPPADAAEEPAAAPPAEEAEPPPPPPPEEEAAPPPAEEPAPPEEAAPPPAEEA
PAEEAAE
Download sequence
Identical sequences A0A1W4UMM8
XP_017040967.1.74164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]