SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W4UNZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4UNZ6
Domain Number 1 Region: 113-233
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.89e-33
Family cAMP-binding domain 0.00000176
Further Details:      
 
Domain Number 2 Region: 243-365
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-30
Family cAMP-binding domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.44e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W4UNZ6
Sequence length 376
Comment (tr|A0A1W4UNZ6|A0A1W4UNZ6_DROFC) cAMP-dependent protein kinase type I regulatory subunit isoform X2 {ECO:0000313|RefSeq:XP_017041432.1} KW=Complete proteome; Reference proteome OX=30025 OS=Drosophila ficusphila (Fruit fly). GN=LOC108088233 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSYMMAKTLEEQSLRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQ
VKLDASRQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEEDAANYVKKVVPKDYKTM
NALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVF
VNSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKM
YEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQ
RSEGEEPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADI
LKRNITQYNSFVSLSV
Download sequence
Identical sequences A0A1W4UNZ6
XP_016933866.1.48971 XP_017005477.1.47939 XP_017041432.1.74164 XP_017121730.1.32376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]