SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W4VMR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4VMR8
Domain Number 1 Region: 81-119
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000106
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0035
Further Details:      
 
Domain Number 2 Region: 8-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000249
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W4VMR8
Sequence length 2013
Comment (tr|A0A1W4VMR8|A0A1W4VMR8_DROFC) uncharacterized protein LOC108098866 isoform X3 {ECO:0000313|RefSeq:XP_017057540.1} KW=Complete proteome; Reference proteome OX=30025 OS=Drosophila ficusphila (Fruit fly). GN=LOC108098866 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MTTTSLPRVPEGLRDLMKVYTKEVLREKPADLYGFSANFFNMIVGEKSHQKVRKYEPVQT
YETIMKNRIRQQVPVSLVFNIIPEKLTDLIKQFIKAVLKEKPENIYIFAQEYFQRMSKEK
SGRIEYTKYSTYEKSLKEKENIHPVSKVTCECGRILSAKSKDVDNKASVYTDTNLAEADQ
KTFSSSITYLQSVVIIQRHFRRYLKQRNLGRQKDKCNSVEYMAAIVMIQKQIRRYLAKKR
VDKLKNSCDAQKPHATFNTADYMKAVVVIQRHYRIYLKRKKEQNRLKNDPVSLATAAIII
QRAFRRMVERLRVKRNASLAADQVEELNDNASETGSYTSVSTALLSTESTELGMANYEER
VHQKIIHEDEEVENNNVDAGLRKDSFAEPIKGEQKSMQLRKSEILSGALIENMITKPNLE
NIKDFNTDSKDLEGYGDIEYGKNKSSQDIEPEVVPKKASLDQESVIQTESKTETREDEVA
SEDKAEIESNKASLDETQDDLKAKMAIQETEPENIDEIKVENANTDCIEKEGSEINEIPN
KMEKVESRESKEFETVTKDDQLDKKDSSTILSNETVLPPKTMSSEEVPMKTEVTPTVSIE
IEHVDDILQDSTTTLQDANGETVPDTLNEDSVEEKSKSLPTDNLKMDSTKQESVEENTLE
VSEDKIISTPMEISEEIITPTTIGKPDISAEKKSSNEHENTTSENIEEPLILVEKSSSVE
HENTTSSKSRGKRSIEDEKIVEISSETPETKIDVDHVKSETDESLEPINQDETQMSNEQQ
LDLGVSSETTPAIEEDPEKPSGAKDETISGSVETVENNLQDPVENVAKASIEEIDLDESN
LQDPVENVAKVSLEEITLDDAAKIDDSITEDKKISAESIELTDGKTQKEDATSKPGSAIS
SGKTHILKAEEKSGSMDDIEAGKRDLEPSTESTRNSEEESGEAVEETELVQTEVMKQSEE
ESAATDPKSLETEEVSSVEVESQHENLKNEHPKPTEEEHEDGSALKHINDGTEVEKDPLR
SSLEVELESSMHAVSEINQDFNEDDKDQPQQDMKKSIEDSVAAVGKISSLKSESSEAEDK
QPDIENVLINSDSVDNYDSKIVDESKELVNISAKEEDSTEVEEKTMVIDPLPTEPETLEM
EGSSLLDEQPIIENVPTNSESVGDNDSRVVDESTKLGNNSVKEQDSTEVVEKKLVKDPLP
IESEAAEIENSTLVDEQPNIENVPTNSESVEDKVSTVVDESTKLDNTSLHNQDSSEVIEK
TLVIEPSPIEPEVVKNEVSTLVKQSLELVTEAPGTTDKTNISVQEKSESTEPVSDLDKTE
PNESLTVLLAEANSPNPETKPLEADASQEEQKDQSSDLEGSKPIGEDLKAKPDSEIPLNS
EQRNSSLLVSNQLIGTQNLPTNHIEIEKNTKKLSSPSIKDKDIGTLTSGRLVPTPIAELQ
LKSFKNPNDDGAWYDIYVEPKVTSDKDFESSSSAVQTSKPDTDRQTSSIVEEPVIVSNRV
LEKTLASVPTNKIVEEPIIAAERVPSYYMPMEIVEAAAPRAKNSVSFFVSFDSDDGKPKY
KIPKRFRDDSKKDKHEEPVNDDINQSESEFDSNEEEIEVIEVSEGDPEYQPPSVSKLQTI
LEHDNENEQPIEGNDQSSDLKPKQPESPIKIIEKEEIRLEKVEPKILSEEKIQKTKDIDS
EYYETLFKTDIIKLSRSVQIIEKAYKRFKNIRQELESDLKKQNEAARVIQKWFRSTLTKK
SDLGSSDSTQKASQNLAAKKIQRAYRRYVEKTKESKSAKEKESLERTQKEEMAALIIQKA
FRLYSQRNNDKLNKVQSSDNNELQQNQAAKKIQRAYRRYLKLSDRQENLRGRKSQEVFKS
EDKEETIGESSMQKLLEIETPGEVNTPKEAESPEVIHGALQNEEQSSETIQGEIDSSQLA
NEPKGIQELKTDEFQEFENLSKVNMSPTHLSKPSENPEFDTELQDIQDPAEDSDSDPKSR
QDLRAEELNDVEEVVETISQSRHIPKLAEEPKK
Download sequence
Identical sequences A0A1W4VMR8
XP_017057540.1.74164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]