SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W4X3F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4X3F9
Domain Number 1 Region: 112-153
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W4X3F9
Sequence length 183
Comment (tr|A0A1W4X3F9|A0A1W4X3F9_AGRPL) uncharacterized protein LOC108740725 {ECO:0000313|RefSeq:XP_018330666.1} KW=Complete proteome; Reference proteome OX=224129 OS=Agrilus planipennis (Emerald ash borer) (Agrilus marcopoli). GN=LOC108740725 OC=Elateriformia; Buprestoidea; Buprestidae; Agrilinae; Agrilus.
Sequence
MLITGFGLRNLSSMQQALLAQRMGDKESVEEEYYGSITDFDKSTSSQTEITLTSSASTVE
IEQKKKKLEYFMGITATMDEAEEEKAEEEVSKYVQFEEVPSEEIFTGDTESMRQAQKYLR
VHRIFEFFQFLIAHLLSAIPDNPIEFLIELLEKCLIYRSGIGEPPLLYRRPHIGKIEISL
TIR
Download sequence
Identical sequences A0A1W4X3F9
XP_018330666.1.13287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]