SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W4XVF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4XVF2
Domain Number 1 Region: 111-231
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-36
Family cAMP-binding domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 240-362
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.11e-32
Family cAMP-binding domain 0.0000029
Further Details:      
 
Domain Number 3 Region: 12-58
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.26e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W4XVF2
Sequence length 373
Comment (tr|A0A1W4XVF2|A0A1W4XVF2_AGRPL) cAMP-dependent protein kinase type I regulatory subunit isoform X1 {ECO:0000313|RefSeq:XP_018336767.1} KW=Complete proteome; Reference proteome OX=224129 OS=Agrilus planipennis (Emerald ash borer) (Agrilus marcopoli). GN=LOC108745162 OC=Elateriformia; Buprestoidea; Buprestidae; Agrilinae; Agrilus.
Sequence
MMATNMDEDQALRECENYVQTHNIQQILKDCIVHLCINRPSNPITFLREYFQKLEREQAL
DAKQQAQSPEDTEDLSPLPVHTQQPVRRRGGISAEPVTEEDATSYVKKVVPKDYKTMAAL
SKAISKNVLFSHLDENERSDIFDAMFPVNCLPGETIIQQGDEGDNFYVIDQGEVEVYINN
ELVTTIGEGGSFGELALIYGTPRAATVKAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEE
FLSRVSILENLDKWERLTVADALEPVSFEDKETIVRQGEAGDDFYIIVEGQAIVMQNRAE
GEEPMEVGRLGPGDYFGEIALLLDRPRAATVVANGPLKCVKLDRARFERVLGLCADILKR
NITQYNSFVSLSV
Download sequence
Identical sequences A0A1W4XVF2
XP_018336767.1.13287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]