SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W4Z3D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4Z3D9
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W4Z3D9
Sequence length 326
Comment (tr|A0A1W4Z3D9|A0A1W4Z3D9_9TELE) sperm surface protein Sp17 {ECO:0000313|RefSeq:XP_018598302.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=spa17 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MSVPFSNTHLRVPRGFGDLLEGLAREVLRDQPKDIPAFAALYFRKLLQEREGSGMDPAEW
TDRCQDRLYDYSFKIKPRPVDASDTSTPVTSPGSTKKEEADSLENQDTEIIVPVQVSAVS
SANFDILEDVPGIDAELSSVNDSDNTTALITGSDGGTASVNICAKELDDPEGGVADEDIC
AKELRQPGEENVNADIGAEDKRDSDEGVDNIDICSKELRHPDESTDEDKTRMDVAGTEDG
SLPNVQTQAKEEASTTTTEPEGLPLEEVAEEQSSTVEAEGEPQEKVSETADHSNQELSEG
EAKDVINPESENNQEGQSGSEPVPDA
Download sequence
Identical sequences A0A1W4Z3D9
XP_018598302.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]