SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W4ZJ05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4ZJ05
Domain Number 1 Region: 27-78
Classification Level Classification E-value
Superfamily Kringle-like 2.2e-17
Family Fibronectin type II module 0.0041
Further Details:      
 
Domain Number 2 Region: 84-135
Classification Level Classification E-value
Superfamily Kringle-like 6.57e-16
Family Fibronectin type II module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W4ZJ05
Sequence length 147
Comment (tr|A0A1W4ZJ05|A0A1W4ZJ05_9TELE) seminal plasma protein HSP-1-like {ECO:0000313|RefSeq:XP_018603699.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=LOC108932033 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MLQLAVIFLLAPAIGGQVIASWQTKVKVQDISPDYCVFPFKYKDHWYYSCTSVDSKHKRL
WCSLTTDFDKDHLWGYCLGNVNFWVTTTESSCVFPFIAGGKTYNHCTTDYWFPGISWCST
TANYDGDKKWVYCPSSGVQVSSIRTGR
Download sequence
Identical sequences A0A1W4ZJ05
XP_018603699.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]