SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5AGN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5AGN4
Domain Number 1 Region: 255-378,405-456
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.17e-26
Family Nucleotide and nucleoside kinases 0.00068
Further Details:      
 
Domain Number 2 Region: 58-243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-22
Family Nucleotide and nucleoside kinases 0.00055
Further Details:      
 
Domain Number 3 Region: 13-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000034
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W5AGN4
Sequence length 478
Comment (tr|A0A1W5AGN4|A0A1W5AGN4_9TELE) adenylate kinase 8 isoform X1 {ECO:0000313|RefSeq:XP_018614883.1, ECO:0000313|RefSeq:XP_018614884.1, ECO:0000313|RefSeq:XP_018614885.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=ak8 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MDGAAERVRIPPEMALYAEKHEIFDLLQCMVRSLMVDKPEEPIEYLIELLSRGRTEVPRI
MVLGPPASGKRTIAVQLCEHTKAVHITASNVLKEDTRLTREARHLRDIQKEIPCELWIKL
IQQCLSKVDCIRQGWVLEGIPHTRQEALLLQEVGIFPEHVVMLEAPDEILIKRSLAKRMD
PASEVDMKLEQQQGFLSEDDIASQLIKYHQEAHALQRTYKNCLKVVKSDQSQDEVFAQVL
SHVQCKPRSMAPHTPRVLLFGPPGSGKSLQAALIAQKYNLVNICCGELLRAVSADETSMG
ELIKPYLASGEPVPDSMVLQIMTERLSRLDCTARGWVLHGFPRDIKQAKMLYEANFIPSR
VFFLEVTDEVASEVVTLRAVDPITGERYHSLYKPAPSPEIEARLQHNPRDSEDRLRSQLK
QYSASVPALKAMYPGALSINVDQDPHAVFETLESWLVQRVTTAGLPGVVMDVKEGGSL
Download sequence
Identical sequences A0A1W5AGN4
XP_018614883.1.37976 XP_018614884.1.37976 XP_018614885.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]