SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5AQD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5AQD0
Domain Number 1 Region: 258-396
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-36
Family cAMP-binding domain 0.00000187
Further Details:      
 
Domain Number 2 Region: 123-254
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-31
Family cAMP-binding domain 0.00000125
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000235
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W5AQD0
Sequence length 403
Comment (tr|A0A1W5AQD0|A0A1W5AQD0_9TELE) cAMP-dependent protein kinase type II-alpha regulatory subunit {ECO:0000313|RefSeq:XP_018617834.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=prkar2a OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MSIEIPAGLTELLQGYTVEVLRQRPPDLVEFAVQYFTRLRESRSQDGAGPGVAAAAAKAT
GKGVMFDGEPMQTESNGDGDEDEDDDSDFEPPPPSRFSRRVSVCAEAFNPDDDEEDTEPR
VVHPKTDEQRCRLQEACRDILLFKTLDQEQFSEVLDAMFELRVQPQEHVIDQGDDGDNFY
VIERGVYDILVQKDGVSCCVGKYDNKGSFGELALMYNTPRAATIMATTEGALWALDRATF
RRLIVKNNAKKRKMYETFIESVPLLKSLELSERMKLVDVLGAKAFQDGEQIIKQGEKADC
FYIVESGEVKIMMKSKTKADQQDNMEVEITRCSRGQYFGELALVTNKPRAASAYAVGDVK
CLVIDVQAFERLLGSCKEIMKRNIAHYEEQLVALFGSSMDLRD
Download sequence
Identical sequences A0A1W5AQD0
XP_018617834.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]