SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CT82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CT82
Domain Number 1 Region: 15-177
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.92e-23
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00031
Further Details:      
 
Domain Number 2 Region: 315-326,369-427,471-505
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000955
Family Pseudo ankyrin repeat 0.039
Further Details:      
 
Domain Number 3 Region: 508-564
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000628
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CT82
Sequence length 605
Comment (tr|A0A1W5CT82|A0A1W5CT82_9LECA) Flavoprotein {ECO:0000313|EMBL:SLM34058.1} KW=Complete proteome; Reference proteome OX=136370 OS=Umbilicaria pustulata. GN= OC=Umbilicariaceae; Umbilicaria.
Sequence
MVIESAANSIQKRFHVLVIQDGAQEHQTAKKILSCFASHVHVIVRAMACTRNNASDYIQI
SAVEDDKFDDLSYELIRGIAHLRPDTILLSKWADLLVVAPIKADTIAKMLHGFSDSILLE
ILRSWDVSKKILMVPGMSTAMWENPMTKKQLNKIRRKWNWIRVLEPVLWGHSRGEVPAMT
GWSGLEELAQNVENQADLMTIGREVDTVTGESSDLPSSDRPTNMQLPPEIWSIILQNVGD
WEVAKSLGIYTTLPVPPEWQRPEITDVPRDFMKDLEWTILTGKHLDIIKHLRSGPPQKWL
SRLCVKLVIKFGLTNLLSYLETHFFDLFWYSFGHTLLPDKASAVFGRTCVLEWWRTSPSF
LNKEYTSEAIDGASKAGFIQVLDWWRDSGLALRYTEAALEQASSKGRTDVLEWWHKASLH
HGSQRIDDSDSSHQRGGSPRLRRSTTWPNPSAVAPQYDVDSHSGLPQPIPLKVGKSLIFA
AQNGQALAVRWWATSGVPLLHEESVPKLASAAGHVEVLQVWKELKGDKMNFDNQVLVAAT
KNGHAEVLEWWRRSDFRVEYKTCDIEEALEDSLGGEGERKVRGWWARNGLNLGVGTSEWM
KVKVL
Download sequence
Identical sequences A0A1W5CT82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]