SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CVR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CVR6
Domain Number 1 Region: 96-189
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.51e-34
Family TATA-box binding protein (TBP), C-terminal domain 0.0000041
Further Details:      
 
Domain Number 2 Region: 181-271
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.83e-31
Family TATA-box binding protein (TBP), C-terminal domain 0.00000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CVR6
Sequence length 273
Comment (tr|A0A1W5CVR6|A0A1W5CVR6_9LECA) Rna polymerase i and iii transcription factor complex component {ECO:0000313|EMBL:SLM34882.1} KW=Complete proteome; Reference proteome OX=136370 OS=Umbilicaria pustulata. GN= OC=Umbilicariaceae; Umbilicaria.
Sequence
MDTLTTHPSTAQQAKAFTSPASLSFPGGAGDLTPPSEKDGNTQANGTSGQTNGANGFVNG
QQQQTQGGNAAPAGNGVTPTTPAATPGAGQTGVSGIVPTLQNIVATVNLDCRLDLKTIAL
HARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKLG
FNAKFTDFKIQNIVGSCDIKFPIRLEGLASRHHHFSSYEPELFPGLIYRMIKPKIVLLIF
VSGKIVLTGAKVREEIYQAFEMIYPVLSDFRKV
Download sequence
Identical sequences A0A1W5CVR6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]