SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W7CW82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W7CW82
Domain Number 1 Region: 1-131,162-213
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.76e-39
Family Nucleotide and nucleoside kinases 0.0000132
Further Details:      
 
Domain Number 2 Region: 126-164
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.000000000613
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W7CW82
Sequence length 218
Comment (tr|A0A1W7CW82|A0A1W7CW82_9ACTN) Adenylate monophosphate kinase {ECO:0000256|HAMAP-Rule:MF_00235} KW=Complete proteome; Reference proteome OX=1109743 OS=Streptomyces sp. SCSIO 03032. GN=CAG99_09300 OC=Streptomyces.
Sequence
MRIVLVGPPGAGKGTQASLLAEHLAIPHISTGDLFRANIRQGTELGRQVDAILREGGLVP
DEVTVAMAADRMAQPDAANGFLLDGFPRNITQAKALDELLAESGTKLNAVLDLEVPEEEV
VRRIAGRRTCRKDSSHTFHVENKPPREEGVCDVCGGELYQREDDQEGTVRKRLAVYHEET
EPIIGYYGEQGLVSTISALAPVPEVTRRALEALPGGGE
Download sequence
Identical sequences A0A1W7CW82
WP_086158571.1.5474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]