SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W7R9Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W7R9Z6
Domain Number 1 Region: 132-271
Classification Level Classification E-value
Superfamily Translational machinery components 1.5e-52
Family ERF1/Dom34 middle domain-like 0.0000632
Further Details:      
 
Domain Number 2 Region: 1-130
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 2.09e-47
Family Dom34/Pelota N-terminal domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 266-370
Classification Level Classification E-value
Superfamily L30e-like 2.65e-32
Family ERF1/Dom34 C-terminal domain-like 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W7R9Z6
Sequence length 383
Comment (tr|A0A1W7R9Z6|A0A1W7R9Z6_9SCOR) Protein pelota homolog {ECO:0000256|RuleBase:RU362019} OX=141984 OS=Hadrurus spadix. GN= OC=Scorpiones; Iurida; Iuroidea; Hadrurus.
Sequence
MKLLGKNIEKDGSGYVTLIPEEPEDMWHAYNLVAEGDSLRSSTIRKVTTESATGSTGSNR
VRTTLTIAIENIDFDTQACMLRVKGRNIMENQYVKMGAYHTLDLELNKKFTLAKSCWDSI
VLDRIEMACDPAQHADLAAVIMHEGLANICLVTSSMTLVRAKIEVNIPRKRKGQCAQHEK
GLQKFFDSVMQGILRHISFDVVKCVIIASPGFVKDQFYEYMFQQAVKLDQKLLLENKSRF
VLVHSSSGFKHSLKEILSDPSISIKLADTKAAGEVKALETFYTMLQNEPSRAFYGLKHVQ
KANEAQAIETLLISDNLFRCQDVSQRKQYVALVDSVKENGGDVKLFSSLHVSGEQLGLLT
GLAAILRFPIPELEEEATSSEED
Download sequence
Identical sequences A0A1W7R9Z6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]