SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W9WGT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W9WGT9
Domain Number 1 Region: 135-260
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.97e-21
Family Heme-binding PAS domain 0.09
Further Details:      
 
Domain Number 2 Region: 84-135
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000000000602
Family HAMP domain 0.002
Further Details:      
 
Domain Number 3 Region: 309-537
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000109
Family PP2C-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W9WGT9
Sequence length 538
Comment (tr|A0A1W9WGT9|A0A1W9WGT9_9CHLR) Uncharacterized protein {ECO:0000313|EMBL:OQY47931.1} KW=Complete proteome; Reference proteome OX=1972460 OS=Anaerolineaceae bacterium 4572_78. GN=B6242_03580 OC=Bacteria; Chloroflexi; Anaerolineae; Anaerolineales; Anaerolineaceae.
Sequence
MVDNVVVQQALQGKSDVRIVKNYQGTSVLSAYQPIKFGNETWVLLVEIPESEALALANSL
RNVTMIIVLISTFLVIGVGIFSARNVTNPILQLTNTTRQIAEGDLDKTVSIHSDDEIGQL
AKTFNLMTNQLRRLIEDLKENARQLAESEKKYRAVFEDSNDLILITDIDGYINDASPACE
YILGYTRAEFKLVNLVDICTNPNDGMLFVNKILSKGSVRDFELKFKRKDNEHIDVLVTAT
GRYAEDDTIIGFQGIVRDVTAMKQAQKERLKLTTLQRELAIAQDMQASLLPPSKPDWKTL
DVVCFSTPAKEVGGDFYTYHAFKTGHFVFAVGDISGKGVAASLLMATSLSQFDSSLSLDL
SPTERMMHLDKNISSYTQPRHQNCAMCYVEIISDSSSKTDNQKTSLLYVVNAGCIPPYIR
RSDGSVEHFIIGGFPLGTGFGVTLGYEQHIFELLTGDMVILTSDGIVEANNEENELLGFD
NLEQIIKDFVPPVSTPSTQGEKQISEVESMLEYIKQRLFDFTGHADQHDDMTIMVIQI
Download sequence
Identical sequences A0A1W9WGT9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]