SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X0CJG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X0CJG8
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily LigT-like 0.0000000000811
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X0CJG8
Sequence length 168
Comment (tr|A0A1X0CJG8|A0A1X0CJG8_9MYCO) Uncharacterized protein {ECO:0000313|EMBL:ORA60119.1} KW=Complete proteome OX=81858 OS=Mycobacterium elephantis. GN=BST23_23485 OC=Mycobacterium.
Sequence
MVHSVELVFDPATEAVIRDIWDALRDAGIPSQAPASRPHATLTVAERIDPAVDELLSPLT
TRFPMPCTIGAPLFFGRAKAVLARLVVPTAALLDVHAEVHSRCMPHLRPGPMSNALPDAW
TAHVTMARRVVPAQMARAVRIAGKPAEIKGAIVGLRRWDGNAKREFAI
Download sequence
Identical sequences A0A1X0CJG8
WP_083043786.1.23632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]