SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X0P532 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X0P532
Domain Number 1 Region: 78-148,179-258
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000133
Family Calmodulin-like 0.0094
Further Details:      
 
Domain Number 2 Region: 17-57
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000196
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X0P532
Sequence length 261
Comment (tr|A0A1X0P532|A0A1X0P532_9TRYP) N/a {ECO:0000313|EMBL:ORC92054.1} KW=Complete proteome; Reference proteome OX=67003 OS=Trypanosoma theileri. GN=TM35_000042680 OC=Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
Sequence
MYEMETFRERTLANRYQPRQHLPPNFPHVLKEYAREVLRAQPDDVLQWSADYFKRLALET
DPLQARQPPSEHYVPVVEDQEREMLLQRLIKAFAEHDNDNTGVLSTQEIKKVLLESFELT
PSQALYVLTSTALVENDTVDYKSFANECVRAVQFFQETHHEFGVGELEDATVHGLSRRDV
EQEFLRIFRYVDEADTGLLPIEQYFQALLNAPYHLTNRDLRLLRIEAARNAENEVDYESE
LAYMFDRLLLAEQFFLFDEDA
Download sequence
Identical sequences A0A1X0P532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]