SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X2GCR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X2GCR4
Domain Number 1 Region: 86-173
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 2.62e-26
Family tRNA-intron endonuclease catalytic domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X2GCR4
Sequence length 176
Comment (tr|A0A1X2GCR4|A0A1X2GCR4_9FUNG) tRNA-intron endonuclease catalytic domain-like protein {ECO:0000313|EMBL:ORX50869.1} OX=101127 OS=Hesseltinella vesiculosa. GN=DM01DRAFT_1408864 OC=Cunninghamellaceae; Hesseltinella.
Sequence
MSDERLVQIQICGDQHLIFDVKDVQHLREKHHIVGSMIGSLPRFPQQNGFYGLPMLLFPE
VAALIIREGLGSWNKKDDSQPFMDELKYQVYRHLWQLGMYMTSGIKFGGDYLAYPGDPMR
FHSHYVVRAQERTQEWTMTELVTMGRLAATTKKTFVLASVMEDEQVETFTIAWAGF
Download sequence
Identical sequences A0A1X2GCR4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]