SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X3K8P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X3K8P6
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily Phage tail protein-like 1.1e-25
Family Lambda phage gpU-like 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X3K8P6
Sequence length 75
Comment (tr|A0A1X3K8P6|A0A1X3K8P6_ECOLX) Phage minor tail protein U {ECO:0000313|EMBL:OSL43542.1} KW=Complete proteome OX=656403 OS=Escherichia coli H461. GN=EARG_02485 OC=Enterobacteriaceae; Escherichia.
Sequence
MKHTELRAAVLDALEKHDTGATLFDGRPAVFDEEDFPAIAVYLTGAEYTGEELDSDTWQA
ELHIEVFLPAQVPDS
Download sequence
Identical sequences A0A1X3K8P6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]