SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X6NPP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X6NPP0
Domain Number 1 Region: 14-50
Classification Level Classification E-value
Superfamily V-type ATP synthase subunit C 0.00000123
Family V-type ATP synthase subunit C 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X6NPP0
Sequence length 89
Comment (tr|A0A1X6NPP0|A0A1X6NPP0_PORUM) Uncharacterized protein {ECO:0000313|EMBL:OSX70535.1} OX=2786 OS=Porphyra umbilicalis (Purple laver) (Red alga). GN=BU14_0728s0001 OC=Eukaryota; Rhodophyta; Bangiophyceae; Bangiales; Bangiaceae; Porphyra.
Sequence
MAPGNMLTFNVDDGYLEAILRGYRSGILTTTDYINLTQCENLEDVRMHLTVRGAPFSLLQ
ASRGSRWRSAWLRRASACVRKCSSAQSSA
Download sequence
Identical sequences A0A1X6NPP0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]